PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v1091120.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 596aa    MW: 66681.6 Da    PI: 5.0644
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v1091120.3genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.39.2e-51161421127
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lp GfrF+P+dee++++yL++k++g+  e+  vi+e+d++k+ePwdLp  + +++++ ew+fF+++d+ky++g+r nrat  gyWkatgkd+++
  Lj1g3v1091120.3  16 LPTGFRFRPSDEEIIDFYLRQKINGNGDEV-WVIREIDVCKWEPWDLPdlSVIRNRDPEWFFFCPQDRKYPNGNRLNRATILGYWKATGKDRKI 108
                      699************************999.89**************96447777888************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyr 127
                      +s +++l+g+kktLvfy+grapkg++t+Wvmheyr
  Lj1g3v1091120.3 109 KS-GSSLIGMKKTLVFYHGRAPKGKRTNWVMHEYR 142
                      **.99*****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-5811166IPR003441NAC domain
PROSITE profilePS5100555.42616166IPR003441NAC domain
PfamPF023654.8E-2617142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 596 aa     Download sequence    Send to blast
MGAVETAVPV LSLNSLPTGF RFRPSDEEII DFYLRQKING NGDEVWVIRE IDVCKWEPWD  60
LPDLSVIRNR DPEWFFFCPQ DRKYPNGNRL NRATILGYWK ATGKDRKIKS GSSLIGMKKT  120
LVFYHGRAPK GKRTNWVMHE YRPTLQELDG TNPGQNPYVI CRLFKKQDES IEVSISGEAE  180
QTASTPMAAK YSPEEVQSDT PLPLVAVSSS LLTEDDKHQA IIPETSEETT SNIITPVDRN  240
SDRYDAQNAQ PQNVKLAAEE NQPLNLDMYN DLKNDIFDDK LFSPALVHLP PVFDYQASNE  300
PDDRSGLQYG TNETAISDLF DSLTWDQLSY EESGSQPMNF PLFNVKDSGS GSDSDFEITN  360
MPSMQIPYPE EAIDMKIPLG TAPEFFSPVG VPFDHSGDEQ KSNVGLFQNQ NAAQMTFSSD  420
VSMGQVYNVV NDYEQPRNWN VATGGDTGII IRARQAQNEL VNTNINQGSA NRRIRLLKSA  480
HGSSRVVKGG RRAQEDRNSK PITAVEKKAS ESLAADEDDT LTNHVKAMPK TPKSTNNRKI  540
YQRGSNAGSS TKVLKDLLLL RRVPCISKAS SNRAMWSSVF VVSAFVMVSV MVFSLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-4311704169NAC domain-containing protein 19
4dul_A2e-4311704169NAC domain-containing protein 19
1ut7_B2e-4311704169NO APICAL MERISTEM PROTEIN
1ut7_A2e-4311704169NO APICAL MERISTEM PROTEIN
1ut4_B2e-4311704169NO APICAL MERISTEM PROTEIN
1ut4_A2e-4311704169NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.125190.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0096580.0AP009658.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT41E18, TM0207, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001276211.10.0uncharacterized LOC100777071
TrEMBLI1JYG10.0I1JYG1_SOYBN; Uncharacterized protein
STRINGGLYMA04G40450.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.28e-90NAC transcription factor-like 9